SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3B452 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3B452
Domain Number 1 Region: 178-274
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000017
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C3B452
Sequence length 284
Comment (tr|A0A0C3B452|A0A0C3B452_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM26266.1} KW=Complete proteome; Reference proteome OX=933852 OS=Serendipita vermifera MAFF 305830. GN=M408DRAFT_194580 OC=Agaricomycetes; Sebacinales; Serendipitaceae; Serendipita.
Sequence
MSRLVKPSLLSLPVELLYEVHIFARNPFLAISCKHIHLILKNAPTIVKVDYLLAEIPERP
TFWPNEIQRVLQYPLCNRHVLERCIGHILPPDHHLDPPSDWPDLSDSEKEKVSFLFPLPK
RLFRDLDRPTVRDETLVTVQYLANLPIVYRGRFDTNGEFVGRDVIRLAPNPDLHQGYALI
RAAQARCIPLIQLLLELGANPSRRNGLAILIAIQQRDLELVKLLVNSEEKREEVDSKKKS
KQDSSSMNSILLDEAVKARASDIVEWLVKEKGCVPDMKTLRAMG
Download sequence
Identical sequences A0A0C3B452
jgi|Sebve1|194580|CE110930_966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]