SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3DJP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3DJP6
Domain Number 1 Region: 425-468,505-543
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000227
Family UBX domain 0.025
Further Details:      
 
Domain Number 2 Region: 192-283
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000268
Family Glutathione peroxidase-like 0.059
Further Details:      
 
Weak hits

Sequence:  A0A0C3DJP6
Domain Number - Region: 7-52
Classification Level Classification E-value
Superfamily UBA-like 0.00442
Family UBA domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C3DJP6
Sequence length 568
Comment (tr|A0A0C3DJP6|A0A0C3DJP6_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM56559.1} KW=Complete proteome; Reference proteome OX=1036808 OS=Scleroderma citrinum Foug A. GN=SCLCIDRAFT_237095 OC=Sclerodermataceae; Scleroderma.
Sequence
MDHLTADQQDAVRQLQAVLDSQNYDTDVLVSVLQSVDWNVQNAMEFLLDGGHAEPSSQSS
SRSVSQDHIPQLPLDQPGRLGGRGPPRTFTSTVLAFLSIPLNVVTGILRFILGVLRIPFL
SFNFGSNIYRPSPRQTHDARGAIRRWITALEEETGAYNIKTSASLATGLDNGPSTSKRHI
YPPTNPESTRVLPDFFDGTYDELLDICQKEGRVACVVLVSEEHDDVPVFKRTTLTDPKLV
RMMNDNNFVVWGGDVRDRIPWDAAQKLQATTYPFVAFLALQPRRNVTPTSSSSSSPVLTV
LSRHYGRSVPDSAPTSAQSLIIHLEQQLLPRVTPFLTRHKAQLKERERDRQLREQQDRAY
QDSQRRDRERIEARRRAEREEAERVRREEDARREEERRIQAERERQESINRLRSQWRRWM
RRAVIPPEPRGGENIRLAIRLPLSGRVVRSFPSSSTVTALYAFADSQTIPSTMQPRDDPE
DPPVGSQGGIEGLEKYIQSQIQDPESWWGFKLALSYPRREVKWSANTSLAEAGLKNGEQL
IMEVTNGVGNGSRSLGHRSDDEYESESD
Download sequence
Identical sequences A0A0C3DJP6
jgi|Sclci1|237095|CE90480_11138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]