SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3E8W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C3E8W5
Domain Number - Region: 171-266
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0366
Family Pseudo ankyrin repeat 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C3E8W5
Sequence length 332
Comment (tr|A0A0C3E8W5|A0A0C3E8W5_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM69170.1} KW=Complete proteome; Reference proteome OX=1036808 OS=Scleroderma citrinum Foug A. GN=SCLCIDRAFT_1208596 OC=Sclerodermataceae; Scleroderma.
Sequence
MDTYFAVLPTDVLDTLILQLNADTQQTPARFLRLPHPRTGVPSLFLPHQTQDATKKSSSM
VLEVQAVAPPNARSWFMGENVVSDGRLLVMTPIDPLFLLIPLLAACKQREGEQVNFRPAD
DIFEEAATNLAEMTLSASQDPSLAITVDDIMRFSALECTRHAMRRVCEVKEITPEITVFR
YSQKKLQEQLKEKIMTLTSPRITEMSRCLIRGLAKDALMEDNYEDLLELGRTRLACDLLG
QYLPPVILAEVVASYDFTKLDAHIRSLKHQQLDPSPVTAAPKKGRKVITTVEDDNNKKRK
KEKNASQGVVKAKKANVQGMATLSTFFSKKTA
Download sequence
Identical sequences A0A0C3E8W5
jgi|Sclci1|1208596|fgenesh1_kg.4_#_218_#_Locus7146v1rpkm12.55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]