SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3JAS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3JAS3
Domain Number 1 Region: 133-231
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.67e-31
Family Thioltransferase 0.00043
Further Details:      
 
Domain Number 2 Region: 5-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.02e-24
Family Thioltransferase 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C3JAS3
Sequence length 234
Comment (tr|A0A0C3JAS3|A0A0C3JAS3_PISTI) Uncharacterized protein {ECO:0000313|EMBL:KIN94771.1} KW=Complete proteome; Reference proteome OX=870435 OS=Pisolithus tinctorius Marx 270. GN=M404DRAFT_1008052 OC=Pisolithaceae; Pisolithus.
Sequence
MAQADNSVHEITSTKQFQDLLSADLNRVSLINFWAPWAEPCKQMNNVVMGLAKKYPQVLV
LQVQAEEQEDISESFDVVSVPTVLLLRGHTLLNRIVGADASELTNAISRHLSGASSLSKP
SSSPDGEESDEQLVTRVKQIMNQSKVVLFMKGSPDAPRCGFSRQAVGLLSDQKVEFTHFD
ILGDEKVRQRLKQLNDWPTYPQIIVNGELVGGLDILKETVETGEFQKMLESTSA
Download sequence
Identical sequences A0A0C3JAS3
jgi|Pisti1|1008052|fgenesh1_kg.143_#_12_#_Locus1904v1rpkm106.41

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]