SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3KMP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3KMP5
Domain Number 1 Region: 9-178
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.13e-17
Family FAD-linked reductases, N-terminal domain 0.0095
Further Details:      
 
Domain Number 2 Region: 181-274
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000403
Family Glutathione peroxidase-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C3KMP5
Sequence length 276
Comment (tr|A0A0C3KMP5|A0A0C3KMP5_PISTI) Uncharacterized protein {ECO:0000313|EMBL:KIO10847.1} KW=Complete proteome; Reference proteome OX=870435 OS=Pisolithus tinctorius Marx 270. GN=M404DRAFT_7446 OC=Pisolithaceae; Pisolithus.
Sequence
MTVHSAPSKVDVLIIGAGPAGVMWANTLVPRRCKRSHRGPTSYGLGDRLLRKDCRVYMAT
FYEPSENGGIKLSRRAPDITAPSARYPFELALRQRAIESIFLDSMKTRGAEVQRSTRPIE
IELSNDAAELADPTSYPVKVTLGRLSPNGTVHHEVVHAKFVLCADGAHSWVRNAFGIAMD
LVLTGDFNAPIQTQKIQALEKSLEQPESFLNQYPRERVLLDDTDVSGTIGGKGYAYYGIP
DEGALVVVRPDGYIVMITPLDGSGEINKYFARFMNA
Download sequence
Identical sequences A0A0C3KMP5
jgi|Pisti1|7446|fgenesh1_pg.8_#_85

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]