SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3P4C5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3P4C5
Domain Number 1 Region: 25-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.18e-26
Family PDI-like 0.0053
Further Details:      
 
Weak hits

Sequence:  A0A0C3P4C5
Domain Number - Region: 168-247
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0277
Family PDI-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C3P4C5
Sequence length 260
Comment (tr|A0A0C3P4C5|A0A0C3P4C5_PISTI) Uncharacterized protein {ECO:0000313|EMBL:KIO07885.1} KW=Complete proteome; Reference proteome OX=870435 OS=Pisolithus tinctorius Marx 270. GN=M404DRAFT_998049 OC=Pisolithaceae; Pisolithus.
Sequence
MLPSSLICLLLTLPALVSAAIFPPNSKVKMLDPKGFKRAMRSNRTAVVAFVAPWCGHCQR
MAPEYSKAAGSLSPLVPFYAVDCDVDTNKALCAQQEVQGFPTIKVFPRGGQLPAQKYEAG
ERTENNLVRWATRSVPNKVKVFKETNDVDEWLGKTSDLPRVILLNKDKKFPFLWQVLANN
YYKKIAFGHRSDADEVFAESLGFVADGKSKVAVYPAGSQVPILYEGGNKFESLSKFFRSI
VDGTADFLQESVRPPVKDEL
Download sequence
Identical sequences A0A0C3P4C5
jgi|Pisti1|998049|fgenesh1_kg.16_#_360_#_Locus9449v1rpkm10.49

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]