SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C3QV44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C3QV44
Domain Number 1 Region: 78-350
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-42
Family Protein kinases, catalytic subunit 0.00072
Further Details:      
 
Domain Number 2 Region: 368-440
Classification Level Classification E-value
Superfamily TPR-like 0.00000000035
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C3QV44
Sequence length 441
Comment (tr|A0A0C3QV44|A0A0C3QV44_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIO32439.1} KW=Complete proteome; Reference proteome OX=1051891 OS=Tulasnella calospora MUT 4182. GN=M407DRAFT_18493 OC=Agaricomycetes; Cantharellales; Tulasnellaceae; Tulasnella.
Sequence
MAPSDPWKSSSKHDPDSLKEGFDALQVRDMETPQSCTGMSVAGVKKAEKFAQKLLATLSG
RRLSISEIKVIGNSPRDGGGYADVLVATLLRKSCNTGEPKKIAVKKLRFVLSDDMTEEKV
FRSFVNELLLLDKMSHPNIVEILSFVEDIEKRIAWLVFLWEDNGNLRDFLRSGKWEIPER
GDTSQIQDVTLRLEYLHTRQPPICHGDLKSLNILVNSSNRAIITDFGSARITNSQQSRLS
VTASNGTLTLTGLTFSFRWAPPEVLNGEQVDLASDMGAGLDRLGAITDCYPFEELDGEFQ
VTMRIVQGQLPLIYGHDQLSRIHLLYSVMERCWNPDPKQRPSSTECRKIIEWVPSAIPVK
QTSERSKIRSATLLLQLGEINRLQNRYEEASNCYMEGLTIAQSTGDWSTLARLLVQLAAN
HQADTHYVEAKSCYTQALSIY
Download sequence
Identical sequences A0A0C3QV44
jgi|Tulca1|18493|gm1.2048_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]