SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C4E219 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C4E219
Domain Number - Region: 897-924,1078-1156
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.017
Family Pseudo ankyrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C4E219
Sequence length 1619
Comment (tr|A0A0C4E219|A0A0C4E219_MAGP6) Uncharacterized protein {ECO:0000313|EMBL:KLU87445.1, ECO:0000313|EnsemblFungi:MAPG_06445T0} KW=Complete proteome; Reference proteome OX=644358 OS=fungus) (Magnaporthe poae). GN=MAPG_06445 OC=Magnaporthiopsis.
Sequence
MADDTGQAVAVKTLSLAEEAWRQSLAEFFGGDPGSVEETLLKLENLEDMLGEAHNAKASH
DAKQLTFEFRGGRYAYIDIFGQVVRHINALKGVIDSGVALDVSGQAALPWAVVKFILGFL
GNYHDQKDAVLSSLASVDHVLVYYRQFESLYFRNQASAAGRHREPTQSPTEDLKSAILEV
YSQCFRILRDTTEWFGQSADKARKGWKDSEKTDARKTALKRSLRNLQDWARKTGKTANKI
FGSSARYSDGVAKIEAGRAKVDMWANLVMRQDQLRAMDLTDRTHALVEKIEHAAFLRGLS
DISSLKEHAALSETILMGSAIWFPRNSKYQEWLMSPKPAALWIHGSLGSGKSTLVCLAID
GFLEGLRPNPTAPVVFFYGVVHSEDGSTWTTRTADDCARDMLRQLVQLNPSSGLPELSSY
VEGNKPSGKTCLKLIEEIIDASAYVSVTFAIDALDRMTLPRGRNSRVALTPGALLDGLVK
LSLSKAGKCLVRILVSSQHRDDIPKSVFEDKKDAAIRVVEIDVDSESPPTIRQFIESQVS
GWIRADFLPGEAGEEGEKARKRARAAVVESVTLHAGRMYLWAQLTLNNIRGNQKLKKETD
LLDELKKLKSPSDITKMYKAIWGGLSGDSRATRVLQLLCCAGKRVATAAVLGALGGADKC
TADDIVKSSGGFITEDHKHGVLALFHPSVKQFLGEQAGYEAQAHTAVAEMCLSTLSEFYQ
DRSQGRRGRSRERQGASSDARRRRSRMRSRSGSRRRGQTRDGLEDPQRKPPGRRQRQRGA
GLEGRDCYDHVLQDFNEYADIYWATHASKSGDPSLGERVARFLGTVHERELWIESAQTRL
SQRPHGFYGHVVEQELKHCWSSHPATSLLVSAVYGFATFIEGEVARAARDSRIRTFEDLR
NDDGLSTFHLAAKFGHIPVLNLLARLTPTPAIFLEPDEKGNNTTAMEYALRNLRTAPEPR
DLEAWLKLKARSGFKVWWVERLKEWYYSNGDREVAFIRECRLVAAALQNPFCAQELLELL
RPKLKMLSSGELPDMEADAVDKGSCREAYQILLQAAVQYAGCSVELLRQGLSMCDKHVTE
AVLVAAARWRNTERVPWRSRRPVWDYLVSGTGTQRLTREVIRAAIKAGDADLTRYLLELV
PQLVLSPEMLEHAVTHRWEALRLIKALLDTTPGEKMIRRVRIITASMLEAMSGNQEQGGE
LLRTLREMSPSAAGDTTEPDLILKTAFRTGNWPFLEELVQTPSRKPRPSYEKVASALVES
LAQPFCVSEASSYALYRPENQRDKQCEAAVSRIVDHFMDGKWEGLDGIPPLAEYQGPAVM
KRLLALAEFDDTALASLLAAAACNKTYGLDIFKLVTQVSNGKVGKLLEHNDLHVVKQVIS
RGHWQVFEHIQKEHADILAVVPEPDLRNAASNPDVRVARFIFSSPIVTGRPALTVEMADL
VRAALNSDAVLDCLMGMPDAPEYRPLRLLKAIAEGCGRTVSLRRALEESGRNRKQPSSRY
IFVDLAHAAIGNKHGIDMLTFVLLLSSVGVTAGMLERAAANRTAAPEMLRVLLNRCEDDR
VSRLITTRVRRAAERNTVSGLEALRILRMEEDFENERKRKERGRKGEIALNVLLQRKLQ
Download sequence
Identical sequences A0A0C4E219
MAPG_06445T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]