SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C4F1Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C4F1Y9
Domain Number 1 Region: 283-376
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000145
Family Thioltransferase 0.057
Further Details:      
 
Domain Number 2 Region: 488-604
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000646
Family UBX domain 0.031
Further Details:      
 
Weak hits

Sequence:  A0A0C4F1Y9
Domain Number - Region: 71-110
Classification Level Classification E-value
Superfamily UBA-like 0.000472
Family UBA domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C4F1Y9
Sequence length 650
Comment (tr|A0A0C4F1Y9|A0A0C4F1Y9_PUCT1) Uncharacterized protein {ECO:0000313|EnsemblFungi:PTTG_07110P0} OX=630390 OS=fungus). GN= OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence
MTHETVTDAVSGWPAEGLAVSTITFGVRISQGRTAMQNQEYILVRLLFANNHTTNQSTKQ
PGSMNPDTLDDEAISSYLSFTNTSDVQAARHALQLANGNLEAAVEAYLDSHSHPTSALLS
NDQERSIYEQLSLDDSSQSDRNLASANGPPNGSATASNHPASAGRSRPSRAFESAPRPRR
SSSKLLSFFFRLWIGPFRLIAIPVSFVADLGLTVFSLLGRLLGLRLPTISFHWPRPSSFG
WTSGPMPRTDPRTAAERWVRELEEELQARSSYTTAQPGDPAIPRLPEFLLLGYDDAVQKA
REELKVLMVVLVSEEHDDVYQFKRGTLMDEELLNLLRTKDILVWGGDVKERDASFAAHVL
DVTTYPFVAFVSLQAKRPSSTVTTITSSVNRSSSNVMSVCTRLEGSPMHSTSSRSLCTTI
NNVVIPRTNGYLSRLRAEKARWEADRRLREQQDRAYAEAGRLDRERVMRKKAEMEAERKR
VEELQQRQLAREKARQERLEEAEQKRRWRYWARREKMPSEPPSTGGGVTIGFRLGDGRRV
VRKFAPDAPLEALYLFVELESASAAIQEEDSSAPLARPSPDYRHSYSFKLSTAMPRRILP
LPDPSPDNCSDHHQISIAKFGGLDGANVNVEGNVTEPGSDEEEEEEEDED
Download sequence
Identical sequences A0A0C4F1Y9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]