SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C7CJV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C7CJV3
Domain Number 1 Region: 47-127
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000235
Family Duffy binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C7CJV3
Sequence length 241
Comment (tr|A0A0C7CJV3|A0A0C7CJV3_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CEG83779.1} KW=Complete proteome OX=58291 OS=Rhizopus microsporus. GN=RMATCC62417_17654 OC=Rhizopodaceae; Rhizopus.
Sequence
MSNENEKSLIVKGSTWPPDYSQYKDLSDDALGQIVENEAQNTQAPEAYKALFGRLLTYCR
SVTESNNRYQQQIHQLNTKCENYLRYIEAARENFENVGELYKEEHIRVLNLKEDNLELRL
QIETYKNELKQAAQQLSEAQKARKEVIQEHERYKELAGRNAEKQGLGRKNLEETLVEKEQ
QIEELQKAVAQLQNLLSLKEVEIRELNTRNKAISIVLEGTRHLQQQQQQQQQQQQNHLNL
S
Download sequence
Identical sequences A0A0C7CJV3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]