SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9MKH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9MKH1
Domain Number 1 Region: 209-310
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.45e-18
Family Regulator of G-protein signaling, RGS 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C9MKH1
Sequence length 427
Comment (tr|A0A0C9MKH1|A0A0C9MKH1_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:GAN02333.1} KW=Complete proteome; Reference proteome OX=91626 OS=Mucor ambiguus. GN=MAM1_0020c01776 OC=Mucoraceae; Mucor.
Sequence
MPTSSSSSLSSTASATRSKRRPSYLNLSTSQQNDIVSDVLSPRTPRSISKSRRSSVVAEH
VQEVIESNAGSRRGSMVSSNSIIAAVAGAGGPPLLSDSTNSYFQDLSSQDDEAIRSETPT
LKARTGSSEDLRNRLSSTAASGSGDSSTSNRRTRSSSISSLLGSTHVLPSFDVHTLYKIK
TTRSSRKLDRFFGEYAPHDICIKEIRKEGLKAILESKAPLCYFLYHLLEEYSSENLQLAT
AQHIFNTYLTRNSYFEVNLDDKVRRTVTQSLEKKNAKTCFESAKRAVYSLLESSYMRFQN
TDTFQDMVKQCGELTAHYNDEARAAAVNKLLAYVEQQHLKIYANDNPTAVFQSTTIRRHE
LIKSMIHEFCRTLVGVEFNYYTPDTSSSNGSSSIHEEPSDATAPGANKFRHVGFPSFGNG
PNASKKR
Download sequence
Identical sequences A0A0C9MKH1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]