SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9T353 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C9T353
Domain Number - Region: 240-307
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0798
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9T353
Sequence length 405
Comment (tr|A0A0C9T353|A0A0C9T353_9HOMO) Unplaced genomic scaffold SPHSTscaffold_657, whole genome shotgun sequence {ECO:0000313|EMBL:KIJ23288.1} KW=Complete proteome; Reference proteome OX=990650 OS=Sphaerobolus stellatus SS14. GN=M422DRAFT_276172 OC=Sphaerobolus.
Sequence
MLCRRCYGIRACNCEDLGNVDAARRGSIVRQLQPLELPDVANPHVALPRALPPAVLLQRA
LGRVIPLFGGATLAQMNSVVQRGVGEGPAEEEEPADEEPAPPIPDAAPAGALPNDPAAEE
HPEPVPPPIVDDVHSEFDGGFDPDDNDYVAPVGDAAPAEEEPAAAEEEPEEEPAAEEEHA
EGEHIPPPIIEDDAAPAEEEPAIKEKPAEASAIDNVQFEFGERVGPDGDDYAAPAPPAPI
NPLPNPATNDDAAQVHPIGVQQVCQHPPGLNGANLLPPSKKAACTDFRHARGNVEYLSLL
MTQQSKEEWEARQRLDILHAQTIKARAAEKDAKVDWLGKRDDSNNTWDGLQVAVQQQRVT
RSVALGVGVSLSNLKTAPAAKRRHRLLSPEPSPPRKRRRPPPTSS
Download sequence
Identical sequences A0A0C9T353
jgi|Sphst1|276172|gm1.38062_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]