SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9UIC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9UIC0
Domain Number 1 Region: 7-135
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000107
Family Ricin B-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9UIC0
Sequence length 136
Comment (tr|A0A0C9UIC0|A0A0C9UIC0_9HOMO) Unplaced genomic scaffold SPHSTscaffold_225, whole genome shotgun sequence {ECO:0000313|EMBL:KIJ28687.1} KW=Complete proteome; Reference proteome OX=990650 OS=Sphaerobolus stellatus SS14. GN=M422DRAFT_189422 OC=Sphaerobolus.
Sequence
MSKPSVGTYTIYSRVLSPSGDKLYMTWNQSDNTVNLEAPTGADNQKWSIKDYNSNTQTIS
PSTASDGQIDYGNGGLSVRPSNDYTFTFRSSSTGYIIADGSGNTNFWKVADAVVYIRATY
GTPSDDLRQRWILEKQ
Download sequence
Identical sequences A0A0C9UIC0
jgi|Sphst1|189422|e_gw1.225.51.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]