SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9UYI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9UYI2
Domain Number 1 Region: 27-156
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.11e-33
Family Ricin B-like 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C9UYI2
Sequence length 161
Comment (tr|A0A0C9UYI2|A0A0C9UYI2_9HOMO) Unplaced genomic scaffold SPHSTscaffold_187, whole genome shotgun sequence {ECO:0000313|EMBL:KIJ30441.1} KW=Complete proteome; Reference proteome OX=990650 OS=Sphaerobolus stellatus SS14. GN=M422DRAFT_268096 OC=Sphaerobolus.
Sequence
MARTSFSLFVFLLPIFAHGQNLIPKNIHPMGNPNKCVDVQGDVRANGTPVQVFDCNGSEA
QKWFVDPDGTHENVILSGGSFCLDAGSTPGNFVPMKIWQCFNTLPQQTWIRTDDGRIALV
NQGLCLDVPNGNLENGQVLQTFKCTDNDQNQFFTFTDTTDF
Download sequence
Identical sequences A0A0C9UYI2
jgi|Sphst1|268096|gm1.29986_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]