SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9VKN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9VKN5
Domain Number 1 Region: 7-147
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000302
Family Ricin B-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C9VKN5
Sequence length 148
Comment (tr|A0A0C9VKN5|A0A0C9VKN5_9HOMO) Unplaced genomic scaffold SPHSTscaffold_88, whole genome shotgun sequence {ECO:0000313|EMBL:KIJ38056.1} KW=Complete proteome; Reference proteome OX=990650 OS=Sphaerobolus stellatus SS14. GN=M422DRAFT_33410 OC=Sphaerobolus.
Sequence
MSLPTGGYAIKNIPTNTFLTIGQTHFQSEGAPIVGLPGPPNKFAWWVVNNTGNNNYEIPW
VQFGVLQPEQSPAGFVYPHGQPVNLATQATATGLVSWTIEAAQNGLFTISASGVFLQMWN
EGTDAYSPITAEMPTNDTSQMWQFIRLD
Download sequence
Identical sequences A0A0C9VKN5
jgi|Sphst1|33410|fgenesh1_kg.88_#_1_#_Locus10859v1rpkm6.55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]