SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9WAV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9WAV7
Domain Number 1 Region: 189-276
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000246
Family Glutathione peroxidase-like 0.056
Further Details:      
 
Domain Number 2 Region: 422-464,501-541
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000362
Family UBX domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C9WAV7
Sequence length 561
Comment (tr|A0A0C9WAV7|A0A0C9WAV7_9HOMO) Unplaced genomic scaffold scaffold_35, whole genome shotgun sequence {ECO:0000313|EMBL:KIJ60721.1} KW=Complete proteome; Reference proteome OX=994086 OS=Hydnomerulius pinastri MD-312. GN=HYDPIDRAFT_116756 OC=Hydnomerulius.
Sequence
MERLSTNQQQVLQQLQALLGPHEHDVEVLISVLQSLDWNVQTATELLLDGPPVEVRSSQR
SIRQTQQPMIPLEYPVQERGHGAPRSLTQTFLALLSLPVSVLSGILRFVLGILRVPFLFN
NNHTYRALRQTFPDTRGATRRWITALEEETGAVSIKSTGALTTGLDNPPSTSRRHAYPPT
SPSDGSKVLPDFFDGTYEEVLDICQREGRIACVILVSDEHDDVPEFKRSTLTDATLVRML
SEKNFVVWGGDVRDKVSWEAAQKLQATTYPFVAFLALQPRRNPSTSSSNSSPILTVLSRH
HGPSVPDSGPTSAQTLVHHLEHQLLPRVNPFLTRYKSQLQERERDRHLREQQDKAFEDSA
RRDRERVEARIREEQEEAGRLRMEEEARRQEEKRTQAERERQESAQAMRLQWRRWMRRSI
VPPEPRGGNAIRLAIKLPGSGRVVRAFPSVSTLTALYAFADAQTIPLTMQLEGDPERVPE
GPEGGLETLENYIQSQTQGPESWWGFKLALAYPRREIKWIANTTLVEAGLKNGEQLVMEA
TNSSYSSTSHPSDDDYESESD
Download sequence
Identical sequences A0A0C9WAV7
jgi|Hydpi2|116756|fgenesh1_kg.35_#_2_#_Locus4302v1rpkm56.34

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]