SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C9WV60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C9WV60
Domain Number 1 Region: 397-472
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000014
Family UBX domain 0.048
Further Details:      
 
Domain Number 2 Region: 199-288
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000015
Family Thioltransferase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C9WV60
Sequence length 579
Comment (tr|A0A0C9WV60|A0A0C9WV60_9AGAR) Unplaced genomic scaffold K443scaffold_47, whole genome shotgun sequence {ECO:0000313|EMBL:KIK03295.1} KW=Complete proteome; Reference proteome OX=1095629 OS=Laccaria amethystina LaAM-08-1. GN=K443DRAFT_485675 OC=Laccaria.
Sequence
MDYLSTEQQQALAQLREIINGADDDVAIGVLSSVDWDVHRAAELIFGTTSASAVPDRVID
TFEVDDTHQSVPERQPSTSILATLTRPVFSFLAFPFHVLSNVFRFIFTILRIPFPSLRFT
SLSFYRPLRPRPSFRRGPDSWLRELEEETGAVSIGRLKLPRGTTSSIGLDAGPSSLTSRA
AAGNSGSGNGASEDGRKVLPDFILRSYEETLRMCQRDAKIACIVLVSEEHDDVAEFKRST
LTDAAFVKSLYDNGIVVWGGDVRDQDAWSAAEKLQATTYPFVAFIALQPGRTPSSSSSPR
TSAPPTLTVLSRHQGRSVPSSAPTSAQTLLNHLEQQVIPRVSPFLERLRATQRERDRDRQ
LRQDQDRAFRDSAQRDKERIEAAIRAERAQQQARIQAEEEERERRRQVEVEKQKEVVRMG
WRKWTRRAFASEQRKSGSLRVAVRLPSGGRSVHQFEGSATLTTLYALVDAQLIPGEFESR
DDPFSPPDLDGVEGGRLALLEAQVESYQNPTAYWGFLIVLAYPRVEIPWRKGVLLGTIEE
LRGGGQVVVELTQSELAGSLSERVASSSVDDGYSTEDSE
Download sequence
Identical sequences A0A0C9WV60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]