SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0CYE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0CYE0
Domain Number 1 Region: 190-277
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000604
Family Glutathione peroxidase-like 0.066
Further Details:      
 
Domain Number 2 Region: 425-466,503-543
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000169
Family UBX domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0CYE0
Sequence length 563
Comment (tr|A0A0D0CYE0|A0A0D0CYE0_9HOMO) Unplaced genomic scaffold scaffold_1144, whole genome shotgun sequence {ECO:0000313|EMBL:KIK80653.1} KW=Complete proteome; Reference proteome OX=930991 OS=Paxillus rubicundulus Ve08.2h10. GN=PAXRUDRAFT_833398 OC=Paxillus.
Sequence
MEHLGASQQEAVKQLQSILGPHDHDVDVLISVLQSLDWNIQDATGLLLNDPQEDSGDNRG
AHRQRLPQVELGNHGHAGGQAPPRPWTQTLFALLSLPINIISGLLRFVLGILRIPLLSLP
LTNATHQGLRQAYPNSRSATRRWITALEEETGAVSFKCVATVASGLDTRPSTSRRNMYPP
ISRADGTKILPDFFDGTYEEVLDICHKEGKIACVILVSDEHDDVPEFKRSTLTDPGFVRV
LTENSFVVWGGDVRDKVSWDAAQKLQATTFPFVAFLALQPRRNLSTNSSSSSSPSLTVLS
RHHGRSVPESGPTSAHTLMHHLEHQLLPRVTPFLTRYKLQLQEHERDRRIREQQDKAFQD
SARRDRERIQARIHAELEEAERVRMEEATHRQEEQRLQAEQERQQRLQALRLQWRRWMRR
CIIPPEVRGGTAVRLALKLSGSSRVVRTFPLNSTLTELYAFADAQTIPLTMQPEGDPEHT
PEGPEGDLQSLENYILLQEQGPESWWGFKLALTYPRREIKWTANTSLVDAGLKSGEQLVM
ELISDNTGASPHLSDDDYESEGN
Download sequence
Identical sequences A0A0D0CYE0
jgi|Paxru1|833398|fgenesh1_kg.1144_#_2_#_Locus2666v1rpkm64.36

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]