SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0KV23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0KV23
Domain Number 1 Region: 12-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000798
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D0KV23
Sequence length 156
Comment (tr|A0A0D0KV23|A0A0D0KV23_9PSED) Uncharacterized protein {ECO:0000313|EMBL:KIQ00948.1} KW=Complete proteome OX=47880 OS=Pseudomonas fulva. GN=RU08_09310 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MELKIVGQISAPPIEATTSLERYCRVKLPQDFIEFLQYGNGGIPEKNLFMHEGTDRLIER
FLPVMLDPNSEDIGEYDISVVMTALDSRLGDDPDEIGCKLIPFAALFSGDFLCLDFRKNA
ECPEVVLWDHNQSDDFAPHTEPVAPSFADFKTLLFT
Download sequence
Identical sequences A0A0D0KV23
WP_042553522.1.65621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]