SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0V4X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0V4X5
Domain Number 1 Region: 12-93
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.93e-20
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D0V4X5
Sequence length 100
Comment (tr|A0A0D0V4X5|A0A0D0V4X5_9TREE) Unplaced genomic scaffold supercont1.9, whole genome shotgun sequence {ECO:0000313|EMBL:KIR39995.1} KW=Complete proteome OX=1296110 OS=Cryptococcus gattii VGII Ram5. GN=I313_03916 OC=Cryptococcus gattii species complex.
Sequence
MSSFAKQIPKAVKEIRLHFCQTSAASAGVRQFVQSSYPAVKSANPDLKFLIREASNISPR
AFVRFERGVESEAQLANLSEPDVGKVLTHLVNQQSGAGVA
Download sequence
Identical sequences A0A095CGT7 A0A0D0V4X5 A0A0D0XDA3 A0A225XA78 A0A226B961 F5HF66 J9VWL5 Q5KCH4
214684.CNH01030 CNAG_05434T0 sgtc|cn12099 XP_012053768.1.45702 XP_572295.1.95466 XP_772481.1.65578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]