SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1Z8N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1Z8N0
Domain Number 1 Region: 42-561
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.34e-83
Family Acetylcholinesterase-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D1Z8N0
Sequence length 568
Comment (tr|A0A0D1Z8N0|A0A0D1Z8N0_9EURO) Carboxylic ester hydrolase {ECO:0000256|RuleBase:RU361235} KW=Complete proteome; Reference proteome OX=212818 OS=Exophiala mesophila. GN=PV10_07714 OC=Exophiala.
Sequence
MARHIYTLGLIAALQGVVVGQGTLPQVDLGYEIHQAISLNETTQLYNFSNIRYAQAPVGE
LRFAAPVAPEGRNETPQNGSVGRICPQAYPAWGLIATEFTRAYVTGNLSSFNFTESEQEL
QALLASGVNSSEEEPDPRISEDCLFLDVIVPRTIFDNANNLRRKRQNAGAPVLVWIYGGG
YVAGEKNSYGSPAGLINASRADGGDGIIYVAMNYRLGAFGFLAGPSLQAEGGVSNAGLYD
QRLALEWVQDNIHLFGGDPNQVTIMGESAGGGSVEHQITAFGGERGVPFQKAIVQSPGFA
PVTSQYTQENTTQEFLALLNVSTIAEARNLSSEAVIRANALQVLTASYSNLVYGPVVDGV
FAPSLPGLALARGSFAENVSVMVGHNTLESPSFSPPFVQTNEELTDFLSEMYASAPPEVV
ETLVTEIYPAEYNGTQPYSSALERTLLIVQEGSFVCNNDYLNRGFDNQTYSYMFQVPPAL
HGQDVAYTFYDGQGSNLALGLLAPVAQVFQAILVNFAKNGDPNGPGVPNFPIYGENATML
AINVTYIEPRPDNTANPRCAWWQKSLLF
Download sequence
Identical sequences A0A0D1Z8N0
XP_016221978.1.28705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]