SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2AZ47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2AZ47
Domain Number 1 Region: 26-495
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.29e-87
Family Fungal lipases 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2AZ47
Sequence length 540
Comment (tr|A0A0D2AZ47|A0A0D2AZ47_9EURO) Carboxylic ester hydrolase {ECO:0000256|RuleBase:RU361235} KW=Complete proteome; Reference proteome OX=569365 OS=Cladophialophora immunda. GN=PV07_06276 OC=Cladophialophora.
Sequence
MKFPVAGASALLLLLNTFTQAQAVPVIDLGYVKYSGYQNATAGINYYRGIRYAAAPTGEL
RWAKPVPIEYMNNYNGQTINASTLGPACYQSSARSTYATPSAPQGQSEDCLLLDVLVPSK
PVSSALPVLFTIHGGGYVGGSAPFSYPGDALVNRSDGNIIYVGIQYRLGMFGFMGGDAIA
ENGALNAGLLDQRAAMDWVQRNIRAFGGDPGRVTIWGGSAGGGSVSCQLIANSGSDFPPF
AAAIADHPWWQPFANKSTQNTQFNTALKLSSCSDINCLRELSSATLGNLNQAVINATYPG
PDNAYGVYYWGPVVDGKFIRDLPDQEFAKGNFYKVPLITNRDAYEGYIFSNMTQTSQVDE
TVDAEDLFPAAGPSFFSRLYSLYPRSNFNSTFYQRQTWFGDFIINCPTYYMASSMVDSLS
NSSAVFKLTFAAGSELHGATNPFISSNVTNYPSANNLTLAHIMTSYWVSFTVFHDPNPLR
TAGAPYWPSYISGAPGSAAQGEGVGFTIQAVTYNSIGATPDPDAAAQCDFFNSRGWQIRN
Download sequence
Identical sequences A0A0D2AZ47
XP_016250753.1.39546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]