SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2PJT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2PJT8
Domain Number 1 Region: 31-176
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 6.67e-46
Family Inorganic pyrophosphatase 0.0000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2PJT8
Sequence length 179
Comment (tr|A0A0D2PJT8|A0A0D2PJT8_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB07129.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_001G150500 OC=Gossypium.
Sequence
MSEEDKNEAKVVETPRKPPRLNERILSSMSRRSVAAHPWHDLEIGPGAPAIFNCVVEIPK
GSKVKYELDKKTGLIKEPVLPGCFLRARALGLMPMIDQGEKDDKIIAVCVDDPEYKHYTD
IKDLPPHRLTEIRRFFEDYKKNENKEVAVDKFLPATAAVEAVQYSMDLYAEYIMQTLRR
Download sequence
Identical sequences A0A0D2PJT8
Gorai.001G150500.5|PACid:26821936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]