SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2QGP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2QGP6
Domain Number 1 Region: 52-282
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.2e-85
Family Inorganic pyrophosphatase 0.000000444
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2QGP6
Sequence length 286
Comment (tr|A0A0D2QGP6|A0A0D2QGP6_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB16071.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_002G211300 OC=Gossypium.
Sequence
MAPTTVAAPSSCMLLKTPFSLKRGSKALSLNNGRRLSKRLFSCNAIYNPQVRIKREGQPE
TLNYRVFFEDASGKKISPWHDVPLHLGNGVFNFIVEIPKESSAKMEVATVELYTPIKQDT
KKGKLRYYPYNINWNYGLLPQTWEDPSFANSEVEGAFGDNDPVDVVEIGDSRGKIGEILK
VKPLAALAMIDEGELDWKIVAISLDDPRASLVNDVNDVEKHFPGTLTAIRNWFRDYKIPD
GKPANKFGLGNKAASKEYALKVIKETNESWAKLVKRSIPAGDLSLV
Download sequence
Identical sequences A0A0D2QGP6
XP_012467748.1.20347 Gorai.002G211300.1|PACid:26795970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]