SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2QXV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2QXV5
Domain Number 1 Region: 459-755
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.12e-77
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 76-152
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-16
Family alpha-D-mannose-specific plant lectins 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2QXV5
Sequence length 807
Comment (tr|A0A0D2QXV5|A0A0D2QXV5_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB21981.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_004G024400 OC=Gossypium.
Sequence
MAAFSIFVFLSGLFVTSSGGLYSHSIRPNFTASFITLVDNSGAFLLSPNATFRAAISNYP
DQQLPQFYFSIIHSSTNTIIWTANRGRPVSDSAKVLLTPNGLVITNNFDQIVWSTPSLDS
PVAFLQLDDSGNLILLDQQNISLWESFNYPTDTLWNGMTYWQLSMDNQAFKESNVLMSFM
AVNGSGLYWVGDDGSTIVFKVPLAPIDAAGLEFIYAKLGSNGKFTISSFDGNNLIPNLQI
PVENCRTPSICEKIGFCNGDKRPETCLCPSAFHNGIDGCVPINPLLTLPKACNTSNSYGN
ETNNQVSYMEIGDAIDYFSTNFIEPLSQRISLLNCQLLCSRNCSCLGVLYGNSSGSCYPI
WNNVGSIFSSTFGLGQDFSGYVKAMTLSSNINLSSKTDTDNKFSVLGSVLIPSLGTLVLV
VLVIGFSWWKTRKWHSRAAVVRLGSKASFSMEIDLLSIAGLPVKFEYEELATATDNFTTQ
IGSGGFGTVYRGVLPDESVVAVKRITNLGVEGKKDFCTEIAIIGNIHHINLVKLKGFCLQ
GKQRFLVLEYMNKGSLDHVIFNNESVLEWKERFKIAVGTARGLAYLHSGCQHKIIHCDVK
PENILLHEENLHQNLQVKISDFGISKLLTPEQSNLLTTLRGTRGYLAPEWLTSSGISEKS
DVFSYGMVLLEIVRGRRNFSIQPCAPLSGTELKRLYFPLLALEMHEQKRYMELVDPKLNG
RAESDEVERLVQVALCCVQMQPWQRPTMSNVVGMLEGSLPVEQPRIESLNFLRIYGGRYA
SVLTTSTDGCNEQNEFIMDYHQSSNDC
Download sequence
Identical sequences A0A0D2QXV5
Gorai.004G024400.1|PACid:26774932 XP_012473056.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]