SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2R5D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2R5D2
Domain Number 1 Region: 2096-2385
Classification Level Classification E-value
Superfamily BEACH domain 3.14e-120
Family BEACH domain 0.0000000169
Further Details:      
 
Domain Number 2 Region: 1974-2084
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-22
Family PreBEACH PH-like domain 0.0025
Further Details:      
 
Domain Number 3 Region: 2502-2575,2616-2695
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.66e-22
Family WD40-repeat 0.0049
Further Details:      
 
Weak hits

Sequence:  A0A0D2R5D2
Domain Number - Region: 326-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000317
Family Clostridium neurotoxins, the second last domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2R5D2
Sequence length 2726
Comment (tr|A0A0D2R5D2|A0A0D2R5D2_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB24651.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_004G155500 OC=Gossypium.
Sequence
MENDYSSTSELRHDSDYSSLGSPIKPKPKADMPTVSSELLHLVDSAIMGRPESLEKLKNI
VSEAESFRSREDVDCSPFLVVDSLIATMGGIESFEEDDENSPPSVMLNSRAAVVAGELIP
WLPWEGDSDIVMSARTRMVRGLLVILRACARNRAMCSMAGLLGVLLRSAENIFTQDVGSI
KQIKWDGTPLCYCIQHLAGHSLSVIDLHGWFQVMTRTITTIWAPHLMLALEKAVCGKESR
GPACTFEFFGECSGLLASGDSRWPFTNGYAFSTWIYIESFADSLNTATAAAAIAAAAAAE
SGKSSAMSAAAAASALAGEGTALMPRLFSFLSTDNQGIEAYFHAQFLVVESGNGKGKKAS
VHFTHPFKPQCWYFIGLEHVCRQGLIGKAENELRLYIDGSLYESRPFEFPRISKPLAFCC
IGTSPPPTTASLQNSQPQCPLFAEMGPVYIFKEPIGPERMARMASRGGDMLPSFGNGAGL
PWLATNDHVQRMAEESSLLDAEIGSCLYVLYHPCLLSGRFCPDASPSGAAGIARRPAEVI
GQVHIATRMRAVEAIWALAYGGPMSLLPLAISNVHQDSLEPEKGSPPLSLATASLAAPIF
RIISVAINHPGNNEEIYRRKGPEILSRILNYLLQTLSSLGAGKDDGARDEELVASVVSIC
LFQKHNYALKVQLFSTLLLDLKIWRLCSYGLQKKLLSSLADMVFTESSVMRDANAMQMLL
DGCRRCYWTIREKDSLDSVSLNGDMRPMGEVNALVDELLVVIELLIGAAPPSMAADDVCC
LLGFMVDCPQSNQVARVLHLIHRLVVQPNATRAQTFAEAFIGSGGIETLLVLLQREAKAG
DHHIPETNTKADESSSVQRSEPGDSGGGVPGQSQNEGSLKERDQTSEKKDFESQPLGCGV
FSPSTKVERISSVSENTFMKNLGGISLSISADNARNNVYNFDKNDGIVVGIIGLLGALVA
RGHLKFGSPVSSEMTSSLFGAELNDAGGGMFEDKVSLLLFALQKALQAAPNRLMTTNVYM
ALLGASINASSTEDGLNLYDSSNHFEHLQLLLVLLRVLPHAPRAFQSRALQDLLFLACSH
PENRSRLTKMEEWPEWILEVHISNYEMDARKQSCSVNLGDIEDLIHNFLIIMLEHSMRQK
DGWKDIEATIHCAEWLSIVGGSSTRDKRIRREESLPIFKRRLLGGLMDFATRELQAQQTQ
LIAAASAGVAAEGLSAKDAKLEAQNAAQLSVFLVENAIVILMLIEDHFRLQSKISNASRK
VDGNASPVHIASSLNNHSNSTVSISRESSEAEDDDISVDSGGLPFDVLSSIADANWQISA
TAMERLTAAAAAEPYDSVSAAFVSYGSCATDIAEGWKYRSRLWYGLGLSEKEVGIGGGGS
GWELWNAALKKDANGNWIELSLVKKSVNMLQALLLDDSGLGDCLGMGGGSGTGMGGMAAL
YQLLDSDQPFLCMLRMVLLSMREEDTGQDNMLTRNVGIEDGMSEGVNHQGGNNMSLDDSA
QIAVGKPWSSLVWSVLSPILNMPISDSKRQRVLVASSVLYSEVWHAVGRDRKPLRKQYLE
AIVPPFVAVLRRWRPVLAGIHDLATPDGLNPLTVDNRILAADAPPLEAALAMVSPAWAAA
FASPPAAMGLAMIAAGASGAETPAPPTTAHLKRDSSMLERKTAKLTTFSSFQKPLEVPTK
TPSHPKDKAAAKAAALAAARDLERNAKIGSGRGLSAVAMATSAQRRNASDMERVKRWNDS
EAMGVAWMECLQPFDTKSVYGKDFNALSYKFIAVLVASFALARNIHRSETDRRGQVDLVA
QYRLFTGIRAWRKLIHYLIEMKCLFGPLGDQFSSQAHIFWKLEFTESSSRMRPCLRRNYI
GTDHIGATSSFEDQNDVKKNQENVISSSNAAIIAAEAISMELVNEDEQPEIDNLDNGTYK
NGQNGEDPPRLSRITEQPLQKSIESAYTKLASVQDLVQSSSAIAPGYVPSEHDDRIVFEL
PSSMVQQLKVMQGTFQVTTTRINFIVDNTESSIGPDGSEGNSEVRNNKKDRCWLMTSLHQ
IYSRRYLLRRSALELFLIDRSNFFFDFGSSDDRRNAYRAIVQARPPHLNNSYLATQRPEQ
LLKKTQLMERWARWEISNFEYLMRLNTLAGRTYNDITQYPVFPWILSDYNSKSLDLADPS
AFRDLSKPIGALNPDRLKKFQERYASFDDSVIPKFHYSSHYSSAGTVLYYLVRVEPFTSL
SIQMQGRNFGQADRVFSDVAATWKGVLEDMSDVKELVPELFYLPEMLTNEKSIGFGTTQS
GGKLGSVKLPPWAENPVDFIRKHRMALESEHVSAHLHEWVDLIFGYKQRGKEAISANNTF
SYITYEGTVNIDKISDPVKQHAIQDQIAYFGQTPSQLLTVPHMKKMPLSKALHLQTIFRN
PKEVKPYAVLVPERCNLPAAAIHASEDAVIIVDRNVPAARIARHKWQPNTPDDQGKPFVF
QHGQATASSASGALTRMFKAPGGSGSDECQFPQALAFASSGIRSSSIVSITCDKEIITGG
HADNSIKILSPDGANTLETAFGHCAPVTCLSLSPDSNYLVTGSRDSTVLLWRIYRASTSG
SNSTPEPPASPRRPPSPARANLAKIIADKSRQHWIEGPIHVLRGHHKEILCCCVSTDLGL
VVSCGLSSDVLLHSIRRGRLIRRLAGVEADAVCLSSEGIILTWNQSKRTLSTFTLNGVLV
ARAQLPSLGGVGCMEISMDGVPCLET
Download sequence
Identical sequences A0A0D2R5D2
Gorai.004G155500.5|PACid:26771936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]