SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2S4Z8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2S4Z8
Domain Number 1 Region: 32-202
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.01e-68
Family Inorganic pyrophosphatase 0.00000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2S4Z8
Sequence length 203
Comment (tr|A0A0D2S4Z8|A0A0D2S4Z8_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB36761.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_006G175500 OC=Gossypium.
Sequence
MAPPIETPTKSSGSHHASHPPLNERILSSMSRRSVAAHPWHDLEIGPGAPMVFNCVIEIP
KGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLIIMQEPVIPGC
FLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNE
NKEVAVNDFLPASTAYEAIQHSL
Download sequence
Identical sequences A0A0D2S4Z8
Gorai.006G175500.3|PACid:26831825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]