SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2SZK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2SZK0
Domain Number 1 Region: 32-198
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.11e-66
Family Inorganic pyrophosphatase 0.00000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2SZK0
Sequence length 264
Comment (tr|A0A0D2SZK0|A0A0D2SZK0_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB36760.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_006G175500 OC=Gossypium.
Sequence
MAPPIETPTKSSGSHHASHPPLNERILSSMSRRSVAAHPWHDLEIGPGAPMVFNCVIEIP
KGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPMDVLIIMQEPVIPGC
FLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNE
NKEVAVNDFLPASTAYEESLRGLHRGELEAVVLGSPCPVYIQIYINMNMNMLLLYKKFIV
SLCGQKHPALTGFATKKMCFSFYR
Download sequence
Identical sequences A0A0D2SZK0
Gorai.006G175500.1|PACid:26831823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]