SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2TAJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2TAJ9
Domain Number 1 Region: 31-211
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.79e-70
Family Inorganic pyrophosphatase 0.00000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2TAJ9
Sequence length 216
Comment (tr|A0A0D2TAJ9|A0A0D2TAJ9_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB53629.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_009G424300 OC=Gossypium.
Sequence
MAPPIETTVKSSDSHCAPHPPLNERILSSMTRRSVAAHPWHDLEIGPGAPTVFNCVIEIG
KGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVLPGC
FLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNE
NKEVAVNDFLPASTAYEAIQHSMNLYADYIVESLRR
Download sequence
Identical sequences A0A0B0Q0H5 A0A0D2TAJ9 A0A1U8NIR8
XP_012443498.1.20347 XP_012443499.1.20347 XP_016738967.1.88148 XP_017612541.1.75545 Gorai.009G424300.1|PACid:26763189 Gorai.009G424300.2|PACid:26763188 Gorai.009G424300.5|PACid:26763190 Gorai.009G424300.9|PACid:26763191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]