SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2WPP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2WPP1
Domain Number 1 Region: 1169-1308
Classification Level Classification E-value
Superfamily SET domain 1.57e-48
Family Histone lysine methyltransferases 0.0047
Further Details:      
 
Domain Number 2 Region: 116-207,372-442
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000012
Family Canonical RBD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2WPP1
Sequence length 1312
Comment (tr|A0A0D2WPP1|A0A0D2WPP1_CAPO3) Setd1a protein {ECO:0000313|EMBL:KJE92663.1} KW=Complete proteome; Reference proteome OX=595528 OS=Capsaspora owczarzaki (strain ATCC 30864). GN=CAOG_003580 OC=Eukaryota; Ichthyosporea; Capsaspora.
Sequence
MSGSAQDDAVARGSDALKDGAANEPSTKDFKVLVDPGLSHDRHAQLERRFDGIDPKTHRS
PCWCLSSCSSSSSSSSSSSSRSRIVDPRRGRPPRYTATLDLTIPRFKFDEHSVGDAPNRI
LFLSELNDNVESSFLLDELRKLGSVETAKVHHHPQTGRHLGIASVVFPSVRECTRLLPLI
DGRTFMGKPVKAELDGSETKRRTEYARLTGTAAAPLTQAPAPTPATPTPPPTSRPPPLLS
TQPQQPPPPPPPPTQLPELPPPPPPPTEPARLASRWGQTPADTAPLLAEPPKPAAPPSRW
GQGPLQKKPSDGGAPGTGLLEWKPSTSGWDDSDVSTATPMATSHASSAGDAHVGNNRYAS
AQNPIAMAPDSIERPNIIVNVNPQLLSRKWLEDRFRSFYVVSIYQSPGDRIWIVEFFNPN
DRDRALNRFDRTTVDGIYLSLSRGPMAPAPVPVPVPAAPLLGLPGTIPVGSMPGGSIPTH
APTGLLPTPGAAKPPLVAAQLIMPPLPPLLPPHLLPPQPAPVIPKLRPLLPEAAAPPPAT
SSSSSSASSSSKPSSSAVPRQSTTIPPLLPASAAKPTSKPSQPSPRNVPKESLEERVIKI
LQQDLIAAVARDLRAQHVEKPAFNKLLEWRAKQAATLKDPKRSGDASHSHTAAATDSNNS
LTAQSNGEAHSTTAVPPARTVPLFQTNILGLGASGAAGRSAVWALPSFRKPGASERRQEH
QPSSSSGSGLSSRLEHGRRGFDAGSQRKDSTRTKPSAKERGSKPARQSSSSGRSERHARV
SDSEDDDESDESSQSSSESSLDSDSEDSRSDGKSAKQTPSKHLPHSSKPSKAEAAAEEQS
VHANALANQGTQKRLKDEKSSASSARGAKRKAHELDDNDSEAAGLPAAGKPDSRPKSSSR
KRAHEDDLDAEAAAASLEPPPVLHDLLLDDISKLSALPTSEGGLARLKLADEQMFASFNG
MRMVVSDNPWHQPHLDVSHLDEEDSWYAAAAARYLEARGMDGGAQGFNAAEEVEATWPLN
LSNLEQYLSNAAKLPVASDALTHQDRTLKRARLHATGSARSEGFYKPSHEDKKLVMHGAP
AYLTGIPGLKFDSTLRNTMYAVTGASDASPQTPGTSSATVSTALASGSPSVLGMANASVN
RANRLQLRQFAAVIEQATNSDTFSLDMLKSRKKLLKFQRSGIHAFGLFSQENISANDLVI
EYVGEVIRQSISDIREHHYERRGIGSSYFFRIDEDHVVDATYKGNLARFMNHCCEPNCYA
KIIMVDGHQRIVIYSKRDIKKGEEITYDYKFPYEENKIPCLCGAVNCKKFLN
Download sequence
Identical sequences A0A0D2WPP1
CAOG_03580T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]