SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2X4K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2X4K1
Domain Number 1 Region: 82-118,150-253
Classification Level Classification E-value
Superfamily RUN domain-like 3.01e-27
Family RUN domain 0.00078
Further Details:      
 
Domain Number 2 Region: 1031-1145
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000525
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 
Domain Number 3 Region: 1147-1295
Classification Level Classification E-value
Superfamily PH domain-like 0.0000063
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2X4K1
Sequence length 1493
Comment (tr|A0A0D2X4K1|A0A0D2X4K1_CAPO3) Uncharacterized protein {ECO:0000313|EMBL:KJE96199.1} KW=Complete proteome; Reference proteome OX=595528 OS=Capsaspora owczarzaki (strain ATCC 30864). GN=CAOG_006557 OC=Eukaryota; Ichthyosporea; Capsaspora.
Sequence
MAHMFEKMLRTTHSVNRAAERQLQHRPEKDKLIGTLQSITKDIQYKFIVAQQQQQQPKQE
AGTGTGTGTTTGTSSSSSSSAATGATALTGSSPEVVELCTAIEAVLRHGLKASHAGHSLA
SSVFHHNAAPQQSSGTTATTGAQALTIDPVRDEFWSYVATISRPEVVQMMTSKLVNVRTP
FGRGRAWVRLALNEKALESYFAIILNDTKARPKLYEDFAFIFDQELVLLLQTLISGLDLV
EFNIPYDINELDNPQYPAPRQPTTPQPQAQPNTPAPTLSPSSATGVPVMTAQAAVQQQQP
PLPASPAPGPPGSPLNLSGLVVSAPASDDALVVSHHVRKAKKPKADAPIADGSADNAAAI
AVAVKKKKKSVATISTPPATANVSSEPPLPAVAAASEAAPAPVATPAKPAAASVTPAPAP
APVTLPAVSALPVANATVPVAAPVPSNPPAPVLSSAAVPTAAPTPAIPRAAASTAAPSVS
APSTTAAPTAAQPVAAPTPAVITATKASKPAATKVAKDEVQIGSRWGAAPSVLSPTSEPS
TIDETLPAKSSIEARYHLPEESFTFEDLMNSPAVVSMKPDGATRGPAGTTGAGAAAATSS
SSSDAGALAQSAKIPTAADALIMPRTNIDAEAIRARAALDTAAPLPETDYMQVAQHLMHN
SSSPPPAEPLNGGAHDVSTSSTLSSVPASVASSYSSLVSDSIKSTTTESSNPSRSASAAP
TQPDVITSSTTASRTYLDIGADRARRAAQQAIVPVDNTVKLSLLLHVFQSDDEQVSFLTT
IRRVDNTNGKIEHTGFFLITTRAFYILNSLGGAPETASSMNMQTLGSEDGTLVDTAVEQS
YPVPELRRVVTGLNGQSVTLDFGGAAKPILLTRDEEAASLIVAQIKIIYAKRGIKTDPLP
AFTSDDSDHSSAIRAAVARKENDAGAIVRLYSLVHWRSVQGVKGDSASDTMSDRHPSGGA
LAEGEELDAAAAAAAAAASDSAATPGLNNERKVTSIALSLMLQGVDYMRPVKHKAGVLPH
SAGSSRLYAAKAGALNYRGHQFKMTHWKQNFFLLQEGVLYHYRSNTDPHPKLAMPVQASS
FHIRRIKESGQPFAFEVTCSQPLPIPGVEPPKSILGLSSAPEDRSFVVSATTEQQMDQWI
AALCLSHVEPLQRPGRHLFKEGSVRYKRVSLVPGASPSERTTLINSMASVKAIDAYLYLF
NDLLLVTTPTDIEGKFELLHAIPVSAVQPAHGGLLDQMQMHTLDQHPQPQLRKQLEATLK
NTCVFTLSSPIVTMELEAESIGDRQDWVQRITAKAESRRVVGNNGSGQKEGQGDTLFTSN
DSNMLDMLAMPFTKVFKSLEEIGGTVVTGVTALGALPAAMAKLSISSSIPVLGLSAAPVI
HTIAPTPPNGFAAAALLVSDRALHLCEENLRQNSVTVLATRGLDAITNLRIDAQYDPDMT
SYCTVMFDDIEHRDDKSWQLAFKTVSETDKFRAALESAWKALFGVELKVQVDM
Download sequence
Identical sequences A0A0D2X4K1
CAOG_06557T0 XP_004345306.1.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]