SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D3EYE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D3EYE5
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.49e-22
Family Thioltransferase 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D3EYE5
Sequence length 104
Comment (tr|A0A0D3EYE5|A0A0D3EYE5_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OBART01G43220.1} KW=Complete proteome; Reference proteome OX=65489 OS=Oryza barthii. GN=4326522 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAERVARLSSQRAVVIFGASNCFMCHVVKTLFSELGVSWAVHEVDKDPNGKDVERALAGM
VGRTPPVPAVFIGGKLVGPTDQVMSLHLAGKLVPLLREAGALWL
Download sequence
Identical sequences A0A0D3EYE5 A0A0D9YJR8 A0A0E0FYH3 A0A0E0N7C6 A2WYT9
OBART01G43220.1 39946.BGIOSIBCE004895 ONIVA01G49150.1 OGLUM01G47520.1 OsIBCD037185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]