SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D3FUF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D3FUF1
Domain Number 1 Region: 39-121
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-17
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 201-310
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000133
Family B3 DNA binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D3FUF1
Sequence length 312
Comment (tr|A0A0D3FUF1|A0A0D3FUF1_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OBART04G08270.1} KW=Complete proteome; Reference proteome OX=65489 OS=Oryza barthii. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAAAAAAAARRGRRSSRFSCLLPSARCYDIQKRAGQQTLHRIPDKFVRDYITGENLNSNM
AIILSPLGKSWRVELDKDQSGVFLGGGWLQFLSFHGISRGDVVIFRYEGNLVFKISVFGP
NGRQKDFKAKGISIHQGTGEQQEAPSFSRRKCNNKKKSRFGEDDGNQQEMPCSRKGSGNK
GRTSDRETKRMRKTRSVYEIGPRSWIKKEINEYVLERCILSLARTFCESIGLAEESSITL
MMIDTTSTQGDQGGSSSSSRSWEVTGRRYKDACYLLGAGWRRFCEDNGVRSGDVCVFTVL
DTTLWRVDIERC
Download sequence
Identical sequences A0A0D3FUF1
OBART04G08270.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]