SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D3GC01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D3GC01
Domain Number 1 Region: 20-237
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 2.36e-38
Family Purine and uridine phosphorylases 0.00058
Further Details:      
 
Domain Number 2 Region: 299-399
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-17
Family B3 DNA binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D3GC01
Sequence length 422
Comment (tr|A0A0D3GC01|A0A0D3GC01_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OBART06G00800.1} KW=Complete proteome; Reference proteome OX=65489 OS=Oryza barthii. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAPPSDSDDSAPIPAGAISKLLIVIAMQTEALPLVNKFHLVEAEESIFPKGAPWIRYHGN
YKGLHVDLVWPGKDPVLGVDCVGTVSAALVTYASIQSLKPDLIINAGTAGGFKAKGADIG
DVYLASDVAFHDRRIPIPVFDMYGIGTRKTFATPNILKELNLKVGKLSTGDSLDMSPHDE
SAILNNDATVKDMEGAAVAYVADMFSTPAIFVKAVTDIVDGEKPTAEEFLQNLVAVTAAL
DKAVTEVMELDTDPTKLKAKPIIKPKVEPCDDDDELPPPPPPASGSGEDWEATTPLAAGN
PFFTALIAKSHLHPKFQMWIPPRFQHRLAEPEARTAAVLHSGGKSWATSYCGHLKMKKLD
AGWSEFAVDNRLLVGDACVFELVAMGATGGLEFQVQILRGGLPSEVVTSKGLTSDQPILI
VD
Download sequence
Identical sequences A0A0D3GC01
OBART06G00800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]