SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6M800 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6M800
Domain Number 1 Region: 34-86
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000111
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 8-35
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000248
Family Somatomedin B domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D6M800
Sequence length 146
Comment (tr|A0A0D6M800|A0A0D6M800_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EPB80250.1} OX=53326 OS=Ancylostoma ceylanicum. GN=ANCCEY_00652 OC=Ancylostoma.
Sequence
MYLEAPPTDCYCDESCVALGDCCSDYTFVCPRRDCAVSSWGPWEGCVADDGTCGIGVQQR
TRYVRQKAERGGKECPPLKEMRTCYTQCPKRRSLDDITTVALLLDYRHNQTRSKMARDNI
YWDLPSVHEKLKEATKYAALVLRIAS
Download sequence
Identical sequences A0A0D6M800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]