SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7WYQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7WYQ9
Domain Number 1 Region: 149-297
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.53e-23
Family SMI1/KNR4-like 0.015
Further Details:      
 
Domain Number 2 Region: 15-114
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000175
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D7WYQ9
Sequence length 297
Comment (tr|A0A0D7WYQ9|A0A0D7WYQ9_9BACL) Cell wall assembly protein {ECO:0000313|EMBL:KJD43848.1} KW=Complete proteome OX=159743 OS=Paenibacillus terrae. GN=QD47_20170 OC=Paenibacillus.
Sequence
MRDNLLPQLEAWHEEDEFEEIVNAIMEIAEEDRNYVLISHLGRALNNLERYEEAVEQFLS
IEEEGKGDPLWHYRIGFAYYYLDQYEEALRSFETADQLDPGDEDTLEFLDLARSKVLQKV
VEVSNAEVDTVVDFDFTDFWDDSEHALEQYVMDDPPTDELIASLEEELVFRLPAFYIHMM
KLHNGGVPQNRCFPIGGSVSGLQEHIRILGVLGIGREKRHSLCGESGSRFRIENGGYPEI
GVVICDCPTESEVVMLDYRESGNDGEPEVVYVDKENNYKITQLAPNFEAFIRGLVKE
Download sequence
Identical sequences A0A0D7WYQ9
WP_044647810.1.30217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]