SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8YCD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8YCD0
Domain Number 1 Region: 73-193
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000581
Family UAS domain 0.019
Further Details:      
 
Domain Number 2 Region: 241-351
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000178
Family UBX domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D8YCD0
Sequence length 388
Comment (tr|A0A0D8YCD0|A0A0D8YCD0_DICVI) Uncharacterized protein {ECO:0000313|EMBL:KJH53694.1} KW=Complete proteome; Reference proteome OX=29172 OS=Dictyocaulus viviparus (Bovine lungworm). GN=DICVIV_00123 OC=Dictyocaulus.
Sequence
MFPTLHSSSTTTKEQRISPSSSTSFRPHQPPRAPSFVPLKFPEIPKKSKDSKGDVIRFRS
DYANKFAIGSRHTVDFFSGSFDEAQKEAKNSIRLILVFIHDPTNEDSAKFIHESLNSVEF
GELVSRNQLIVWGVANDSDEGKYVAFYQHVFKFPFLGLMCPRGDGRFFTARRTSGFITAI
DLIEKLQKSCDVLQSELKELRKQKEIIMENRRIMEEQEKAYKESAERDKQKILKAKKARE
EKLEAEKKQQEKQKQMEQRRQMIAEKRGELKLQVEQQPTGNELVNVQVRFPSGKKFSKKF
SLDDSLEKLFIAIFCYETCPDFFTVATGFPRSEIHCAPEWYHALLSAQLTSDGLVAKPFR
QASSFRAAGLGRAVGVFVNNHGTNSDSY
Download sequence
Identical sequences A0A0D8YCD0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]