SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9QZ51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9QZ51
Domain Number 1 Region: 341-471
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.47e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 444-588
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000033
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 182-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000466
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 306-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 5 Region: 256-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000345
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D9QZ51
Sequence length 703
Comment (tr|A0A0D9QZ51|A0A0D9QZ51_CHLSB) Fibulin-1 {ECO:0000256|PIRNR:PIRNR036313} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=FBLN1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MERAAPSRRVPLPLLLLGGLALLAAGVDADVLLEACCADGHRMATNQKDCSLPYATESKE
CRMVQEQCCHSQLEELHCATGISLANEQDHCAAPRGDNASLEATFVKRCCHCCLLGRAAQ
AQGQSCEYNLMVGYQCGQVFRACCVKSQETGDLDVRSLQETDKITEVEEEQEDPYLNDRC
RGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSF
RCQRDSSCGTGYELTEDNSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQ
DALGNCIDINECLSISAPCPTGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDEC
APPAEPCGRGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLG
SYVCSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCE
DIDECALPTGGHICSYRCINIPGSFQCSCPASGYRLAPNGRNCQDIDECVTGIHNCSINE
TCFNIQGSFRCLAFECPENYRRSAATLQQEKTDTVRCIKSCRPNDVTCVFDPVHTISHTV
ISLPTFREFTRPEEIIFLRAITPPHPASQANIIFDITEGNLRDSFDIIKRYMDGMTVGVV
RQVRPIVGPFHAILKLEMNYVVGGVVSHRNVVNVHIFVSEYWF
Download sequence
Identical sequences A0A0D9QZ51
XP_007974269.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]