SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9R2V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9R2V9
Domain Number 1 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.87e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.91e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 178-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 234-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 7 Region: 293-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 1-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-21
Family KRAB domain (Kruppel-associated box) 0.00054
Further Details:      
 
Domain Number 9 Region: 598-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-20
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 10 Region: 140-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.95e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 93-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000171
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 12 Region: 337-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000292
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D9R2V9
Sequence length 655
Comment (tr|A0A0D9R2V9|A0A0D9R2V9_CHLSB) Uncharacterized protein {ECO:0000313|Ensembl:ENSCSAP00000002948} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MFQDSVVFEDVAVNFTQEEWALLGPSQKKLYRDVMQETFVNLASIGENWEEKNTEDHKNQ
GRKLRSHMVERLCERKEGSQFGETISQTPNPKPNKKTFTRVKPYECSVCGKDYMCHSSLN
RHMRSHTEHRSYEYHKYGEKSYECKECGKRFSFRSSFRIHERTHTGEKPYKCKQCGKAFS
WPSSFQIHERTHTGEKPYECKECGKAFIYHTTFRGHMRMHTGEKPYKCKECGKTFSHPSS
FRNHERTHSGEKPYECKQCGKAFRYYQTFQIHERTHTGEKPYQCKQCGKALSCPTSFRSH
ERIHTGEKPYKCKKCGKAFSFPSSFRKHERIHTGEKPYDCKECGKAFISLPSYRRHMIMH
TGNGPYKCKECGKAFDCPSSFQIHERTHTGEKPFECKQCGKAFSCSSSFRMHERTHTGEK
PHECKQCGKAFSCSSSVRIHERTHTGEKPYECKQCGKAFSCSSSFRMHERIHTGEKPYEC
KQCGKAFSFSSSFRMHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPYECKQCG
KAFSCSSSIRIHERTHTGEKPYECKQCGKAFSCSSSVRMHERTHTGEKPYECKQCDKAFS
CSRSFRIHERTHTGEKPYACQQCGKAFKCSRSFRIHERVHSGEKPCECRQCGKIF
Download sequence
Identical sequences A0A0D9R2V9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]