SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9R4K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9R4K9
Domain Number 1 Region: 159-268
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.09e-34
Family PDI-like 0.0037
Further Details:      
 
Domain Number 2 Region: 21-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.63e-33
Family PDI-like 0.0021
Further Details:      
 
Domain Number 3 Region: 279-389
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000449
Family DsbC/DsbG C-terminal domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D9R4K9
Sequence length 440
Comment (tr|A0A0D9R4K9|A0A0D9R4K9_CHLSB) Protein disulfide isomerase family A member 6 {ECO:0000313|Ensembl:ENSCSAP00000003548} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=PDIA6 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MALLGLGLVSCAFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQR
LTPEWKKAATALKDVVKVGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTG
EAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDV
WMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTI
KIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVA
VLPHILDTGAAGRNSYLEVLLKMADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMA
AINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELP
VEDDIDLSDVELDDLGKDEL
Download sequence
Identical sequences A0A0D9R4K9 A0A1D5QRL3 A0A2K5MMW8 A0A2K5X5U8 A0A2K6BPM2
NP_001253564.1.72884 XP_005576620.1.63531 XP_007969684.1.81039 XP_007969685.1.81039 XP_011747684.1.29376 XP_011900023.1.92194 ENSMMUP00000016897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]