SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9R8G4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9R8G4
Domain Number 1 Region: 72-135
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.5e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9R8G4
Sequence length 201
Comment (tr|A0A0D9R8G4|A0A0D9R8G4_CHLSB) Scleraxis bHLH transcription factor {ECO:0000313|Ensembl:ENSCSAP00000004903} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=SCX OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MSFATLRPAPPGRYLYPEVSPLSEDEDRGSDSSGSDEKPCRVHAARCGLQGARRRAGGRR
AGGGGPGGRPGREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLA
SSYISHLGNVLLAGEACGDGQPCHSGPAFFHAARAGSPPPPPPPPPARDGENTQPKQICT
FCLSNQRKLSKDRDRKTAIRS
Download sequence
Identical sequences A0A096NFP0 A0A0D9R8G4 A0A2J8RHN5 A0A2K5KID7 Q7RTU7
gi|148922889|ref|NP_001073983.1| gi|186972126|ref|NP_001008272.1| NP_001073983.1.92137 XP_006716679.1.92137 XP_008000096.1.81039 XP_008000097.1.81039 XP_011905587.1.92194 XP_011905588.1.92194 XP_011905589.1.92194 ENSP00000342868 ENSP00000345599 ENSP00000476384 ENSP00000476384 9606.ENSP00000342868 9606.ENSP00000345599 ENSP00000342868 ENSP00000345599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]