SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9RBG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RBG0
Domain Number 1 Region: 145-459
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.7e-99
Family Protein kinases, catalytic subunit 0.0000000000568
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily PH domain-like 1.65e-24
Family Pleckstrin-homology domain (PH domain) 0.000000676
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RBG0
Sequence length 480
Comment (tr|A0A0D9RBG0|A0A0D9RBG0_CHLSB) Non-specific serine/threonine protein kinase {ECO:0000256|SAAS:SAAS01030073} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=AKT1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKHEEEMMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Download sequence
Identical sequences A0A096NK32 A0A0D9RBG0 A0A2K5L125 A0A2K6CQV7 F6RCU6 G7PBQ9
ENSPANP00000013336 9544.ENSMMUP00000032525 ENSMMUP00000001399 NP_001248554.1.72884 XP_005562407.1.63531 XP_007986188.1.81039 XP_007986189.1.81039 XP_011753322.1.29376 XP_011939558.1.92194 XP_011939559.1.92194 XP_015000007.1.72884 ENSMMUP00000001399 ENSMMUP00000032525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]