SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9RDI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RDI9
Domain Number 1 Region: 273-418
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.41e-18
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 
Domain Number 2 Region: 36-75
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000262
Family KRAB domain (Kruppel-associated box) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RDI9
Sequence length 492
Comment (tr|A0A0D9RDI9|A0A0D9RDI9_CHLSB) KRAB-A domain containing 2 {ECO:0000313|Ensembl:ENSCSAP00000006678} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=KRBA2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MPSFLMPSLVSSTVLLRLLLFPGPKTVWSLWQQPVLSQEATAFEDMTKYWNYLEASQKDC
YRDTMLDSYENTVPQASFLQFSMMPQRAGNDPPGVSNVNEMEMEISNMREKFLMSVTKLV
ESKSYNSKVFSKEKYFQTIKEVKEAKEKGKKSSRDYRRAAKYDVISVQGTEKLIEATHGE
RDRIRYYVHKEELFDILHDTHLSIGHGGRTRMLKELQGKYGNVTKEVIVLYLTLCKQCHQ
KNPVPKKGLPPKPMTFKDTDSTCQVEILDMQSSADGEFKFILYYQDHLTKFIILRPLRTK
QAREVVSVLLDIFTILGTPTVLDSDSGVEFTNQVVQELNELWPDLKIVSGKYHPGQSQGS
LEGASRDVKNMISTWMQSNHSCHWAKGLRFLQMVRNQAFDVSLQQSPFEAMFGCKAKFGL
YSSNLPRETVATLQTEEELEIAEEQLENSLWIRQEERVEIGADRSDMDDDMDPTPEATEP
STSQGASGLLCW
Download sequence
Identical sequences A0A0D9RDI9
XP_008008483.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]