SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9RJE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RJE9
Domain Number 1 Region: 100-124
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000301
Family CCCH zinc finger 0.0045
Further Details:      
 
Weak hits

Sequence:  A0A0D9RJE9
Domain Number - Region: 127-176
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.0785
Family BRCA2 tower domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RJE9
Sequence length 426
Comment (tr|A0A0D9RJE9|A0A0D9RJE9_CHLSB) Zinc finger CCCH-type containing 15 {ECO:0000313|Ensembl:ENSCSAP00000008738} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=ZC3H15 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MPPKKQAQAGGSKKAEQKKKEKIIEDKTFGLKNKKGAKQQKFIKAVTHQVKFGQQNPRQV
AQSEAEKKLKKDDKKKELQELNELFKPVVAAQKISKGADPKSVVCAFFKQGQCTKGDKCK
FSHDLTLERKCEKRSVYIDARDEELEKDTMDNWDEKKLEEVVNKKHGEAEKKKPKTQIVC
KHFLEAIENNKYGWFWVCPGGGDICMYRHALPPGFVLKKDKKKEEKEDEISLEDLIERER
SALGPNVTKITLESFLAWKKRKRQEKIDKLEQDMERRKADFKAGKALVISGREVFEFRPE
LVNDDDEEADDTRYTQGTGGDEVDDSVSVNDIDLSLYIPRDVDETGITVASLERFSTYTS
DKDENKLSEASGGRAENGERSDLEEDNEREGPENGAIDAVPVDENLFTGEDLDELEEELN
TLDLEE
Download sequence
Identical sequences A0A096MTK4 A0A0D9RJE9 A0A2K5LHK3 A0A2K5YSW4 A0A2K6BTE6 A0A2K6NUG3 F7H9Q2 G7PKZ8 H2QJ41
ENSMMUP00000022684 NP_001245127.1.72884 XP_003823567.1.60992 XP_007963763.1.81039 XP_010368607.1.97406 XP_011716662.1.29376 XP_011855459.1.47321 XP_011902603.1.92194 XP_515965.2.37143 ENSPANP00000003138 ENSPTRP00000021742 9544.ENSMMUP00000022684 9598.ENSPTRP00000021742 ENSPTRP00000021742 ENSMMUP00000022684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]