SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9RL12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RL12
Domain Number 1 Region: 81-218
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.56e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.000000198
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.79e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RL12
Sequence length 222
Comment (tr|A0A0D9RL12|A0A0D9RL12_CHLSB) Glutathione S-transferase alpha 4 {ECO:0000313|Ensembl:ENSCSAP00000009301} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=GSTA4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLHKLQDGNHLLFQQVPMVEI
DGMKLVQTRSILHYIADKHNLFGKDLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKE
VVNMAQKAIIRYFPVFEKILRGHGQNFLVGNQLSLADVILLQTILALEEKIPNILSAFPF
LQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFKP
Download sequence
Identical sequences A0A096NJ89 A0A0D9RL12 A0A2K5L7J5 A0A2K6A8D9 F6TP78 G7P4V9
ENSPANP00000013038 NP_001245031.1.72884 NP_001271624.1.63531 XP_007970437.1.81039 XP_011836690.1.47321 XP_011925274.1.92194 ENSMMUP00000019558 ENSMMUP00000019558 9544.ENSMMUP00000019558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]