SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9RQP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RQP5
Domain Number 1 Region: 157-250
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.34e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RQP5
Sequence length 252
Comment (tr|A0A0D9RQP5|A0A0D9RQP5_CHLSB) Partner of NOB1 homolog {ECO:0000313|Ensembl:ENSCSAP00000010934} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=PNO1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MESEMEAQSAGAEEGFTQVTRKGGRRAKKRQAEQLSAAGEGGDAGRMDTEEARPAKRPVF
PPLCGDGLLSGKEETRKIPVPANRYTPLKENWMKIFTPIVEHLGLQIRFNLKSRNVEIRT
CKETKDVSALTKAADFVKAFILGFQVEDALALIRLDDLFLESFEITDVKPLKGDHLSRAI
GRIAGKGGKTKFTIENVTRTRIVLADVKVHILGSFQNIKMARTAICNLILGNPPSKVYGN
IRAVASRSADRF
Download sequence
Identical sequences A0A0D9RQP5 A0A2I3H5E8 A0A2K5KYL5 A0A2K5Z6A4 A0A2K6BQN6 F7HKB6 G3R194 H2QI04 I7GPI7
ENSPTRP00000020608 ENSGGOP00000008949 ENSMMUP00000022985 9544.ENSMMUP00000022985 9598.ENSPTRP00000020608 ENSMMUP00000022985 NP_001270946.1.63531 XP_003262524.1.23891 XP_007968603.1.81039 XP_011711757.1.29376 XP_011895038.1.92194 ENSNLEP00000012184 ENSNLEP00000012184 ENSGGOP00000008949 ENSPTRP00000020608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]