SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9RQR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RQR9
Domain Number 1 Region: 5-236
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.32e-52
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 352-396,431-568
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.75e-19
Family Ankyrin repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  A0A0D9RQR9
Domain Number - Region: 258-283,327-374
Classification Level Classification E-value
Superfamily TPR-like 0.00175
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RQR9
Sequence length 617
Comment (tr|A0A0D9RQR9|A0A0D9RQR9_CHLSB) Fem-1 homolog C {ECO:0000313|Ensembl:ENSCSAP00000010958} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=FEM1C OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MDLKTAVFNAARDGKLRLLTKLLASKSKEEVSSLISEKTNGATPLLMAARYGHLDMVEFL
LEQCSASIEVGGSVNFDGETIEGAPPLWAASAAGHLKVVQSLLNHGASVNNTTLTNSTPL
RAACFDGHLEIVKYLVEHKADLEVSNRHGHTCLMISCYKGHKEIAQYLLEKGADVNRKSV
KGNTALHDCAESGSLDIMKMLLMYCAKMEKDGYGMTPLLSASVTGHTNIVDFLTHHAQTS
KTERINALELLGATFVDKKRDLLGALKYWKKAMNMRYSDRTNIISKPVPQTLIMAYDYAK
EVNSAEELEGLIADPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFKRCINL
WKYALDMQQSNLDPLSPMTASSLLSFAELFSFMLQDRAKGLLGTTVTFDDLMGILCKSVL
EIERAIKQTQCPADPLQLNKALSIILHLICLLEKVPCTLEQDHFKKQTIYRFLKLHPRGK
NNFSPLHLAVDKNTTCVGRYPVCKFPSLQVTAILIECGADVNVRDSDDNSPLHIAALNNH
PDIMNLLIKSGAHFDATNLHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIY
YKGHIPEKLETFVSLHR
Download sequence
Identical sequences A0A096MM60 A0A0D9RQR9 A0A2K5EW17 A0A2K5IIG7 A0A2K5NLN9 A0A2K5RF85 A0A2K5Y045 A0A2K6BQW3 A0A2K6L4C7 A0A2K6PE66 A0A2K6UGI4 F6UHD7 F6UV06 G1RM41 G3QWB1 G7P828 H2PGB1 H2QRC5 Q96JP0
ENSGGOP00000007066 ENSPPYP00000017556 ENSP00000274457 ENSPTRP00000029345 ENSCJAP00000030797 9544.ENSMMUP00000019809 9598.ENSPTRP00000029345 9600.ENSPPYP00000017556 9606.ENSP00000274457 gi|17864094|ref|NP_064562.1| ENSNLEP00000014305 ENSP00000274457 ENSPTRP00000029345 ENSP00000274457 ENSNLEP00000014305 NP_001253466.1.72884 NP_064562.1.87134 NP_064562.1.92137 XP_001147155.1.37143 XP_002744740.1.60252 XP_003259901.1.23891 XP_003826772.1.60992 XP_003920734.1.74449 XP_004042420.1.27298 XP_005272092.1.92137 XP_005356129.1.66349 XP_005557604.1.63531 XP_006977724.1.50099 XP_008012373.1.81039 XP_009239241.1.23681 XP_010355225.1.97406 XP_011771197.1.29376 XP_011819049.1.43180 XP_011826436.1.47321 XP_011925843.1.92194 XP_012294141.1.9421 XP_012294142.1.9421 XP_012294143.1.9421 XP_017357509.1.71028 XP_017357510.1.71028 XP_017744507.1.44346 XP_017825223.1.60252 ENSMMUP00000019809 ENSPPYP00000017556 ENSCJAP00000030797 ENSGGOP00000007066 ENSMMUP00000019809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]