SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9RW49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RW49
Domain Number 1 Region: 1123-1299
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.0006
Further Details:      
 
Domain Number 2 Region: 685-800
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.01e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 3 Region: 877-1038
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-24
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 4 Region: 450-572
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-24
Family Pleckstrin-homology domain (PH domain) 0.0000113
Further Details:      
 
Domain Number 5 Region: 1433-1570
Classification Level Classification E-value
Superfamily PH domain-like 1.82e-19
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 6 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.77e-17
Family SAM (sterile alpha motif) domain 0.0000298
Further Details:      
 
Domain Number 7 Region: 586-684
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000308
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 8 Region: 1015-1109
Classification Level Classification E-value
Superfamily PH domain-like 0.000000225
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RW49
Sequence length 1703
Comment (tr|A0A0D9RW49|A0A0D9RW49_CHLSB) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSCSAP00000012838} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=ARAP2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRI
LNQLQIILSKMQDFPIYANVHKTKKNDDPSKDHTVPSSDHNICIELSSSSSVQTPSPPQL
ETVTKKLEEDASVERSQYPQSDNKLSPPKRDFSTAEEPHLNLGSLNDSLFGSENIKIESL
ITKKTMDHTIEEQQTEKVKLISENLNKLPNADSECLSSVGCSTSETNSRNGTNGLLDGSP
PSPFFKFQGEMIVNDLYVPSSPILAPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGISG
SYFRERRNVATSTEKSVAWQNSNEENSSSIFPYGETFLFQRLENSKKRSIKNEFLTQEEA
LKGEATTATNSFIIKSSIYDNRKEKISEDKVEDIWIPREDKNNFLIDTASESEYSTVEEC
FQSLRRKNSKASKSRTQKALTLDSVNRHSYPLSSTSGNADSSAVSSQAISPYACFYGASV
KKVKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAISTVRVQGDN
KFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSLTSQSQGIVTPEKCGYLELRGYKA
KIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFTA
ETEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICK
KCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMDS
PVEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCA
TGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGVLSQESSQSTFLCDFLYQ
APAAASKLSSEKKLLEETNKKWCVLEGGFLSYYESDKSTTPNGTININEVICLAIHKEDF
YLNTGPIFIFEIYLPSERVFLFGAETSQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQL
FYKDCHALDQWRKGWFAMDKSSLHFCLQMQEVQGDRMHLRRLQELTISTMVQNGEKLDVL
LLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQ
YGLGCKYIYQNNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTGVLKSFLSDIDDALL
TKELYPYWISALDAQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMNA
HNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQ
VSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVIE
NEELERPLHYKENVLEQVLRWSSLAEPGSAYLVVKKFLTADTIKHCSDRSTLGSIKEGIL
KIKEEPSKILSGNKFQDRYFVLRDGFLFLYKDVKSSKHDKMFSLSSVKFYRGVKKKMKPP
TSWGLTAYSEKHHWHLCCDSSRTQTEWMTSIFIAQHENDIWPPAGKERKRSITKNPKIGG
LPLIPIQHEGNATLARKNIESARAELERLRLIEKCDKESVDSSLKERASMVAHCLEHKDD
KLRNRTRKHRSFNCLEDTEPEAPLGQPKGHKGPKTLRKTEDRNSKATLDSDHKLPSRVIE
ELNVVLQRSRTLPRELQDEQILK
Download sequence
Identical sequences A0A0D9RW49
XP_008015868.1.81039 XP_008015869.1.81039 XP_008015870.1.81039 XP_008015871.1.81039 XP_008015872.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]