SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9RYA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RYA3
Domain Number 1 Region: 530-608
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000285
Family Canonical RBD 0.016
Further Details:      
 
Domain Number 2 Region: 888-958
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000114
Family Canonical RBD 0.023
Further Details:      
 
Weak hits

Sequence:  A0A0D9RYA3
Domain Number - Region: 290-316
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000106
Family CCCH zinc finger 0.004
Further Details:      
 
Domain Number - Region: 9-76
Classification Level Classification E-value
Superfamily PWI domain 0.00235
Family PWI domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RYA3
Sequence length 1007
Comment (tr|A0A0D9RYA3|A0A0D9RYA3_CHLSB) RNA binding motif protein 26 {ECO:0000313|Ensembl:ENSCSAP00000013592} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=RBM26 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MVSKMIIENFEALKSWLSKTLEPICDADPSALAKYVLALVKKDKSEKELKALCIDQLDVF
LQKETQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKF
SRRLNHSPPQSSSRYRENRSRDERKKDDRSRKRDYDRNPPRRDSYRDRYNRRRGRSRSYS
RSRSRSWSKERLRERDRDRSRTRSRSRTRSRERDLVKPKYDLDRTDPLENNYTPVSSVPS
ISSGHYPVPTLSSTITVIAPTHHGNNTTESWSEFHEDQVDHNSYVRPPMPKKRCRDYDEK
GFCMRGDMCPFDHGSDPVVVEDVNLPGMLPFPAQPPVVEGPPPPGLPPPPPILTPPPVNL
RPPVPPPGPLPPSLPPVTGPPPPLPPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPP
SLFTADTYDTDGYNPEAPSITNTSRPMYRHRVHAQRPNLIGLTSGDMDLPPREKPPNKSS
MRIVVDSESRKRTIGSGEPGVPTKKTWFDKPNFNRTNSPGFQKKVQFGNENTKLELRKVP
PELNNISKLNEHFSRFGTLVNLQVAYNGDPEGALIQFATYEEAKKAISSTEAVLNNRFIK
VYWHREGSTQQLQTTSPKVMQPLVQQPILPVVKQSVKERLGPVPSNTIEPAEAQSATSDL
PQNVTKLSVKDRLGFVSKPSVSATEKVLSTSTGLTKTVYNPAALKAAQKTLLVSTSAVDN
NEAQKKKQEALKLQQDVRKRKQEILEKHIETQKMLISKLEKNKTMKSEDKAEIMKTLEVL
TKNITKLKDEVKAASPGRCLPKSIKTKTQMQKELLDTELDLYKKMQAGEEVTELRRKYTE
LQLEAAKRGILSSGRGRGIHSRGRGAVHGRGRGRGRGRGVPGHAVVDHRPRALEISAFTE
SDREDLLPHFAQYGEIEDCQIDDSSLHAVITFKTRAEAEAAAVHGARFKGQDLKLAWNKP
VTNISAVETEEVEPDEEEFQEESLVDDSLLQDDDEEEEDNESRSWRR
Download sequence
Identical sequences A0A0D9RYA3 A0A1D5QV86 A0A2K6DQ12
XP_005586122.1.63531 XP_007958847.1.81039 XP_010360132.1.97406 XP_011739711.1.29376 XP_014976774.1.72884 ENSPANP00000003302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]