SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9RYU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RYU5
Domain Number 1 Region: 118-620
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-161
Family Calponin-homology domain, CH-domain 0.00000000272
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily EF-hand 3.04e-18
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RYU5
Sequence length 627
Comment (tr|A0A0D9RYU5|A0A0D9RYU5_CHLSB) Lymphocyte cytosolic protein 1 {ECO:0000313|Ensembl:ENSCSAP00000013784} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=LCP1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMAT
GDLDQDGRISFDEFIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSE
EEKYAFVNWINKALENDPDCRHVIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTI
NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADI
ELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCNKIGNFSTDIKDSKAYY
HLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGNP
KLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDL
SDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGG
QDLNEGNRTLTLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLREAQKSSSISS
FKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYAL
PEDLVEVNPKMVMTVFACLMGKGMKRV
Download sequence
Identical sequences A0A096MR65 A0A0D9RYU5
ENSPANP00000002260 XP_007958549.1.81039 XP_007958550.1.81039 XP_011829975.1.47321 XP_011829976.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]